General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0AI91",
        "id": "LUXS_LISW6",
        "source_organism": {
            "taxId": "386043",
            "scientificName": "Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)",
            "fullName": "Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)"
        },
        "name": "S-ribosylhomocysteine lyase",
        "description": [
            "Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the environment. The regulation of gene expression in response to changes in cell density is called quorum sensing. Catalyzes the transformation of S-ribosylhomocysteine (RHC) to homocysteine (HC) and 4,5-dihydroxy-2,3-pentadione (DPD)"
        ],
        "length": 155,
        "sequence": "MTEKMNVESFNLDHTKVKAPFVRLAGTKVGLHGDEIYKYDVRFKQPNKEHMDMPALHSLEHLMAELARNHTDKLVDISPMGCQTGFYVSFINHNDYDDALEILATTLTDVLAATEVPACNEVQCGWAASHSLEGAQALAAEFLAKRDEWKNVFGE",
        "proteome": null,
        "gene": "luxS",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043768",
                "name": "S-ribosylhomocysteine lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009372",
                "name": "quorum sensing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d416792ee549289affa401b5b604f54b39bb12b3",
        "counters": {
            "domain_architectures": 7897,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7897
        }
    }
}