"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AB39Z8L6"	"{'domain_architectures': 61465, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'cdd': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'pirsf': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 61465}"	"['Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome', ""Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA. Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway""]"	"LOC108009942"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000398', 'name': 'mRNA splicing, via spliceosome', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0AB39Z8L6_DROSZ"	"83b18cf71a575d59c0de6840812ffe7912383fc4"	True	False	79	"U6 snRNA-associated Sm-like protein LSm6"	3	"UP001652628"	"MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRV"	"unreviewed"	"{'taxId': '28584', 'scientificName': 'Drosophila suzukii', 'fullName': 'Drosophila suzukii (Spotted-wing drosophila fruit fly)'}"