"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AAX6TAP1"	"{'domain_architectures': 28012, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 28012}"	"['Terminal enzyme of the cyclooxygenase (COX)-2-mediated prostaglandin E2 (PGE2) biosynthetic pathway. Catalyzes the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) in response to inflammatory stimuli. Plays a key role in inflammation response, fever and pain. Also catalyzes the oxidoreduction of endocannabinoids into prostaglandin glycerol esters and PGG2 into 15-hydroperoxy-PGE2. In addition, displays low glutathione transferase and glutathione-dependent peroxidase activities, toward 1-chloro-2,4-dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively']"	"Ptges"	"[{'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0AAX6TAP1_HETGA"	"e2cf1f5163a84e238f4e7981be2ccc606dab93d5"	True	False	False	185	"Prostaglandin E synthase"	3	"UP000694906"	"MPPSGLALADSRALPAFLLCSTLLVIKMYVVAVITGQVRLRKKAFANPEDALRHGGLQFCRSNPDVERCLRQATPGLGQDLAQIWLGLSCGSPKPGTQRVPSRAHRNDMETIYPFLFLGLVYCFLGPSPAAAWGHFLPFLLGRLLHTVAYLGQLRAPVRSLAYTVAQLPCASMALQILWEAARHL"	"unreviewed"	"{'taxId': '10181', 'scientificName': 'Heterocephalus glaber', 'fullName': 'Heterocephalus glaber (Naked mole rat)'}"