"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AAJ6QRF4"	"{'domain_architectures': 6674, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'cdd': 1, 'ssf': 2, 'smart': 1, 'panther': 1, 'pfam': 2, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6674}"	"['Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3)']"	"LOC100904941"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0AAJ6QRF4_9ACAR"	"850be910b9cd318f3ca2b561f721d758cdaf390e"	False	False	False	280	"5'-AMP-activated protein kinase subunit beta-1"	3	"UP000694867"	"MGNTSSGKRERTFSNEAPCSPGKEDRALEFNTKRFQAQNSLDENEKFLNSLRQNEDFMRPRASTVSSSTPSAPMSTGTGKNGVLPTVFKWEXGGRDVAICGTFTQWKPIPMVKSHGDFVIILDVPEGEHEYKFKVDGNWHCDEGEPQVDTEGTKKNVIKVKQSDFEVFEALAVDSLATQSANVVSGSPTGDYTQDIPTKSVQEQTTSSKQQGPPILPPHLLQVILNKDIPLSCEPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTTLLYKPI"	"unreviewed"	"{'taxId': '34638', 'scientificName': 'Galendromus occidentalis', 'fullName': 'Galendromus occidentalis (western predatory mite)'}"
