"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AAJ4ZES3"	"{'domain_architectures': 5497, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5497}"	"['Catalyzes the phosphorolysis of diverse nucleosides, yielding D-ribose 1-phosphate and the respective free bases. Can use uridine, adenosine, guanosine, cytidine, thymidine, inosine and xanthosine as substrates. Also catalyzes the reverse reactions']"	"ppnP"	""	"A0AAJ4ZES3_PANPU"	"cb075b3ccb9d7f5677132b0cb821b74f2816dd8b"	True	False	False	107	"Pyrimidine/purine nucleoside phosphorylase"	3	"UP000035086"	"MTQNATQFDNVSVIKRANTYFDGKCVSHTVLFPDGTRKTLGVIFPATLQFGTDAPEIMEVTGGRCRIRLAGQTEWQEYATGQQFSVPGNSKFDIEVVETLDYVCHYG"	"unreviewed"	"{'taxId': '93221', 'scientificName': 'Pandoraea pulmonicola', 'fullName': 'Pandoraea pulmonicola'}"
