"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AAD6ML73"	"{'domain_architectures': 70645, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'smart': 1, 'panther': 1, 'pirsf': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 70645}"	"[""Component of LSM protein complexes, which are involved in RNA processing. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by promoting decapping and leading to accurate 5'-3' mRNA decay. The cytoplasmic LSM1-LSM7 complex regulates developmental gene expression by the decapping of specific development-related transcripts. Component of the nuclear LSM2-LSM8 complex which is involved splicing nuclear mRNAs. LSM2-LSM8 binds directly to the U6 small nuclear RNAs (snRNAs) and is essential for accurate splicing of selected development-related mRNAs through the stabilization of the spliceosomal U6 snRNA. Plays a critical role in the regulation of development-related gene expression""]"	"NC653_020628"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000398', 'name': 'mRNA splicing, via spliceosome', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0AAD6ML73_9ROSI"	"83b18cf71a575d59c0de6840812ffe7912383fc4"	True	False	False	91	"Sm domain-containing protein"	3	"UP001164929"	"MSTGGEKGSATTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQTEEYVNGQLKNKYGDAFIRGNNVLYISTSKRTLADGA"	"unreviewed"	"{'taxId': '444605', 'scientificName': 'Populus alba x Populus x berolinensis', 'fullName': 'Populus alba x Populus x berolinensis'}"
