"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0AAD2AI80"	"{'domain_architectures': 44517, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 44517}"	"['NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient', 'NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient']"	"nuoB"	"[{'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0048038', 'name': 'quinone binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0AAD2AI80_9RALS"	"ec2bdf213efa2e994a9300f4d128e854c4d858c2"	True	False	False	160	"NADH-quinone oxidoreductase subunit B"	3	"UP001190452"	"MAIEGVLNEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGASRYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALIYGIIQLQAKIRRTNTIARKA"	"unreviewed"	"{'taxId': '105219', 'scientificName': 'Ralstonia mannitolilytica', 'fullName': 'Ralstonia mannitolilytica'}"
