"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A9F2RB69"	"{'domain_architectures': 11257, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pfam': 1, 'pirsf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 11257}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"NDUFA8"	"[{'identifier': 'GO:0006120', 'name': 'mitochondrial electron transport, NADH to ubiquinone', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A9F2RB69_PYTBI"	"2bfa9d5678d3ac03401fc5186f94ab36ffbe9a59"	True	False	False	165	"NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8"	3	"UP000695026"	"MARLTFGFPQLPIGTAVLKAGAHHYGSQCDRINKEFMLCRWEEKDPRKCLKEGRAVSQCAVDFFRQIKLHCAEPFTQYWTCIDDSNVLEFRHCRKQQQLFDDCVLQKLGWVRPDLGQLSKVTKVKTDRPIPENPCHSRSRPPPNPPVEGEYKPAKYGNRGVFWSW"	"unreviewed"	"{'taxId': '176946', 'scientificName': 'Python bivittatus', 'fullName': 'Python bivittatus (Burmese python)'}"
