"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A9B0T7M2"	"{'domain_architectures': 0, 'entries': 2, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"LOC102828888"	"[{'identifier': 'GO:0022904', 'name': 'respiratory electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A9B0T7M2_CHRAS"	""	True	False	False	77	"NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5"	3	"UP000504623"	"MAGLLKKTTGLVGLAVCDSPHEEPDVKKLEDQLQGGQIEEVIFQAENELSLVRKMMLWKPWEPSVEEPLANQWKWPI"	"unreviewed"	"{'taxId': '185453', 'scientificName': 'Chrysochloris asiatica', 'fullName': 'Chrysochloris asiatica (Cape golden mole)'}"
