"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A9B0BS91"	"{'domain_architectures': 3102, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3102}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"LOC100646553"	"[{'identifier': 'GO:0005739', 'name': 'mitochondrion', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A9B0BS91_BOMTE"	"4756edf77cd959a8b060109947bb407ec2c364d4"	True	False	123	"NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7"	3	"UP000835206"	"MGNTFQKMFSSDPFPPSDSEPTFDPMYGFPKERKERVMPISEEDLIAAKVPPEYRDYCADVFLEYNRCFIKKFPFVVLCAEEAHKYQECEYNDDVLRAKEYERERRLLVRERRRQRAMEAVTA"	"unreviewed"	"{'taxId': '30195', 'scientificName': 'Bombus terrestris', 'fullName': 'Bombus terrestris (Buff-tailed bumblebee)'}"
