"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A974HAS2"	"{'domain_architectures': 146351, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'ssf': 1, 'cdd': 1, 'smart': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 146351}"	"['Transcriptional repressor of genes that require a bHLH protein for their transcription. Plays an important role as neurogenesis negative regulator']"	"hes5.7.S"	"[{'identifier': 'GO:0046983', 'name': 'protein dimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A974HAS2_XENLA"	"15b86a07eaabcbc71b6ebb705399c8a22c21f484"	True	False	False	155	"Transcription factor HES-5"	4	""	"MAPYNASSMLNTEHCHKAQGIRKIRKPVVEKMRRDRINSSIEQLRMLLEKEFEKHHLPSKPEKADILEVAVSFLEQHMASKSAQSSNRSHMEGHSRCLQDSLHCLSPKHLGFPEKLLHNIYVDSSLTVSPPLSPLYQTHTKCTTPEADKVLWRPW"	"unreviewed"	"{'taxId': '8355', 'scientificName': 'Xenopus laevis', 'fullName': 'Xenopus laevis (African clawed frog)'}"
