"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A918YTY6"	"{'domain_architectures': 77231, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'cdd': 1, 'pirsf': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 77231}"	"['Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. Together with AhpD, DlaT and Lpd, constitutes an NADH-dependent peroxidase active against hydrogen and alkyl peroxides as well as serving as a peroxynitrite reductase, thus protecting the bacterium against reactive nitrogen intermediates and oxidative stress generated by the host immune system. Does not however seem to play a role in detoxification of isoniazid']"	"GCM10007167_00560"	"[{'identifier': 'GO:0016209', 'name': 'antioxidant activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A918YTY6_9GAMM"	"a21e48547e25de76b0bffd3fe920a04fbf2958a9"	True	False	179	"Alkyl hydroperoxide reductase C"	4	"UP000636453"	"MLTIGDKFPQFKVKATVGIDNLGTAFADIDNETYKGKWLCVFFYPKDFTFVCPTEIKGFADMNQQFLDRDCQILAASTDSEFVHLAWRKDHKDLRDLPFPMLADIKKELTTALGILGEDGVAQRATFLVDPDGIIRFVYVTDGSVGRNPQEVLRVLDALQTDELCPCNWHKGEETLKVA"	"unreviewed"	"{'taxId': '1169913', 'scientificName': 'Vulcaniibacterium thermophilum', 'fullName': 'Vulcaniibacterium thermophilum'}"