"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8P4KC79"	"{'domain_architectures': 13729, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'smart': 2, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 13729}"	"['Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction']"	"gng12b"	"[{'identifier': 'GO:0007186', 'name': 'G protein-coupled receptor signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0031681', 'name': 'G-protein beta-subunit binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005834', 'name': 'heterotrimeric G-protein complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A8P4KC79_DICLA"	"6a9480ece7c587f54416519bfe41f3d087d848e1"	True	False	False	69	"Guanine nucleotide-binding protein subunit gamma"	3	"UP000694389"	"KMIFSSSIAQARRTVQQLRIEASIERIKVSKASADLMRYCGEHAKNDPLLMGIPASENPFKDKKPCTVL"	"unreviewed"	"{'taxId': '13489', 'scientificName': 'Dicentrarchus labrax', 'fullName': 'Dicentrarchus labrax (European seabass)'}"