"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8M1ML36"	"{'domain_architectures': 283, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'pirsf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 283}"	"['The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. The coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated with ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors']"	"COPE"	"[{'identifier': 'GO:0005198', 'name': 'structural molecule activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006890', 'name': 'retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A8M1ML36_NEOSC"	"d75228b92c7a00ccb2786069164e81e49589df12"	True	False	257	"Coatomer subunit epsilon"	3	"UP000248481"	"MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAYLAQRKYGVVLDEIKPSSAPELQAVHMFAEYLANNSRSMAMTVQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVNLAVGGEKLQDAYYIFQEMADKCSSTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPEALINLIVLSQHLGKPPEVTNRYLSQLKDAHRCHPFIKEYQAKENDFDRLVLQYAPSA"	"unreviewed"	"{'taxId': '29088', 'scientificName': 'Neomonachus schauinslandi', 'fullName': 'Neomonachus schauinslandi (Hawaiian monk seal)'}"
