"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8J0USB3"	"{'domain_architectures': 3893, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3893}"	"['Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process']"	"hsbp1.L"	"[{'identifier': 'GO:0003714', 'name': 'transcription corepressor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A8J0USB3_XENLA"	"f29886ab4101a0363507121d30a1a2175694fa66"	True	False	False	74	"Heat shock factor-binding protein 1"	3	"UP000186698"	"MSETDPKTVQDLTVVVQNLLQQMQDKFQTMSDQIIGRIDDMSTRIDDLEKNIADLMTQAGVEEEESANKQPPPK"	"unreviewed"	"{'taxId': '8355', 'scientificName': 'Xenopus laevis', 'fullName': 'Xenopus laevis (African clawed frog)'}"