"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8D2EE22"	"{'domain_architectures': 33949, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 33949}"	"['Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residues', 'Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance']"	""	"[{'identifier': 'GO:0033743', 'name': 'peptide-methionine (R)-S-oxide reductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016671', 'name': 'oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006979', 'name': 'response to oxidative stress', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030091', 'name': 'protein repair', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A8D2EE22_THEGE"	"deb4c5e8efd21b1ddf07e78fdbd67304e03e4fcf"	True	False	False	182	"Peptide-methionine (R)-S-oxide reductase"	3	"UP000694411"	"MARLLWLLRGLTLGAAPRRAVRGRAGGGEPCTGPVLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH"	"unreviewed"	"{'taxId': '9565', 'scientificName': 'Theropithecus gelada', 'fullName': 'Theropithecus gelada (Gelada baboon)'}"