"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8D1PDB2"	"{'domain_architectures': 27639, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 27639}"	"['Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis. Binds its own mRNA and that of DHFR2']"	"DHFR"	"[{'identifier': 'GO:0004146', 'name': 'dihydrofolate reductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0046654', 'name': 'tetrahydrofolate biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0050661', 'name': 'NADP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A8D1PDB2_PIG"	"18e639bb52cd0649ef370776485d30568df413de"	True	False	False	187	"Dihydrofolate reductase"	3	""	"MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEYKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLTEQPELKNKVDMVWIVGGSSVYKEAMNKPGHIRLFVTRIMKEFESDTFFPEIDLEKYKLLSECSGVPSDVQEEKGIKYKFEVYEKNN"	"unreviewed"	"{'taxId': '9823', 'scientificName': 'Sus scrofa', 'fullName': 'Sus scrofa (Pig)'}"