"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8C6RN73"	"{'domain_architectures': 6343, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6343}"	"['Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment']"	"Atp6v1g3"	"[{'identifier': 'GO:0046961', 'name': 'proton-transporting ATPase activity, rotational mechanism', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:1902600', 'name': 'proton transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016471', 'name': 'vacuolar proton-transporting V-type ATPase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A8C6RN73_NANGA"	"7c72f5cfb54e999401c719af7748d86a7865c469"	True	False	False	118	"V-type proton ATPase subunit G"	3	"UP000694381"	"MTSQSQGIQQLLQAEKRAKDKLEEAKKRKGRRLKQATEEAVGETDRYRMQREKAFRLKQSKIMGPQSNLADEIEEQTVEKLKELSRSYNTYMESVMKQLLSMVCDLKPEIHVNYRASN"	"unreviewed"	"{'taxId': '1026970', 'scientificName': 'Nannospalax galili', 'fullName': 'Nannospalax galili (Northern Israeli blind subterranean mole rat)'}"
