"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8C5VRJ1"	"{'domain_architectures': 0, 'entries': 2, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1}"	"['As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD): it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated']"	"LAMTOR4"	"[{'identifier': 'GO:0032008', 'name': 'positive regulation of TOR signaling', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0071230', 'name': 'cellular response to amino acid stimulus', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0071986', 'name': 'Ragulator complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A8C5VRJ1_MICMU"	""	True	False	False	99	"Ragulator complex protein LAMTOR4"	3	"UP000694394"	"MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHQGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV"	"unreviewed"	"{'taxId': '30608', 'scientificName': 'Microcebus murinus', 'fullName': 'Microcebus murinus (Gray mouse lemur)'}"
