"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8C4KUI5"	"{'domain_architectures': 10240, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'smart': 2, 'pfam': 1, 'profile': 1, 'panther': 1, 'prosite': 2, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 10240}"	"['Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9. Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis. Also modulates the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels. Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes. In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors']"	"S100A4"	"[{'identifier': 'GO:0046914', 'name': 'transition metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005509', 'name': 'calcium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A8C4KUI5_EQUAS"	"9fbe415715d177c71b45cd24325edde000517727"	True	False	False	101	"Protein S100"	3	""	"MAYPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNKDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK"	"unreviewed"	"{'taxId': '83772', 'scientificName': 'Equus asinus asinus', 'fullName': 'Equus asinus asinus'}"