"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8C3PFP5"	"{'domain_architectures': 6436, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'hamap': 1, 'pirsf': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6436}"	"[""Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. SNRPC/U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region"", ""Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. snrpc/U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates E complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region""]"	"SNRPC"	"[{'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0030627', 'name': ""pre-mRNA 5'-splice site binding"", 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000395', 'name': ""mRNA 5'-splice site recognition"", 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000398', 'name': 'mRNA splicing, via spliceosome', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005685', 'name': 'U1 snRNP', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A8C3PFP5_CHRPI"	"b3d4a988413dcb14e72275512e7fed5e9885436e"	True	False	False	159	"U1 small nuclear ribonucleoprotein C"	3	"UP000694380"	"MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPNMPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPSRPMMVPTRPGMTRPER"	"unreviewed"	"{'taxId': '8478', 'scientificName': 'Chrysemys picta bellii', 'fullName': 'Chrysemys picta bellii (Western painted turtle)'}"