"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8B8VB94"	"{'domain_architectures': 48716, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'hamap': 1, 'pirsf': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 48716}"	"['Component of the small ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome']"	"LOC118881384"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A8B8VB94_BALMU"	"27014fae6cee778a178c41ffe67c2e7489fd17c3"	False	False	False	151	"Small ribosomal subunit protein uS11"	3	"UP000694857"	"MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVNADXDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALARSGTKIGQTEDVTPIPSDSTRRKGGRRGHSL"	"unreviewed"	"{'taxId': '9771', 'scientificName': 'Balaenoptera musculus', 'fullName': 'Balaenoptera musculus (Blue whale)'}"