"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8B8RBY3"	"{'domain_architectures': 86430, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'cdd': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 86430}"	"['Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins']"	"HSPB1"	""	"A0A8B8RBY3_CAMFR"	"1a49c7cd006c7b597e6e0f45e18cc046e51a1431"	True	False	False	201	"Heat shock protein beta-1"	3	"UP000694856"	"MAERRVPFSLLRSPSWDPFRDWYPAHSRLFEQAFGLPRLPEEWSQWLSHSGWPGYVRPLHPAAIEGPAYSRALSRQLSSGVSEIQQTADRWRVSLDVNHFAPEELTVKTKDGVVEITGKHEERQDEHGFISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKPVTQSAEITIPVTFEARAQLGGPEAGKSEQPGAK"	"unreviewed"	"{'taxId': '419612', 'scientificName': 'Camelus ferus', 'fullName': 'Camelus ferus (Wild bactrian camel)'}"