"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7X2RTY5"	"{'domain_architectures': 34638, 'entries': 18, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'profile': 1, 'pfam': 2, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 34638}"	"['Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body', 'With S4 and S12 plays an important role in translational accuracy']"	"rpsE"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015935', 'name': 'small ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A7X2RTY5_9PSED"	"ddb47877d1b64f864fa25e376c154e201459d42b"	True	False	False	166	"Small ribosomal subunit protein uS5"	3	"UP000431485"	"MSNNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQKAMEAARRNMIQVDLNGTTLQYAMKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKRGKSVKEIF"	"unreviewed"	"{'taxId': '1055468', 'scientificName': 'Pseudomonas karstica', 'fullName': 'Pseudomonas karstica'}"
