"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7U6GF52"	"{'domain_architectures': 28756, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 28756}"	"['Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation']"	"secE"	"[{'identifier': 'GO:0008320', 'name': 'protein transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009306', 'name': 'protein secretion', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0006605', 'name': 'protein targeting', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006886', 'name': 'intracellular protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A7U6GF52_CALEA"	"0d41e4e71441ccac4f46a43da1a097dd754b8912"	True	False	False	83	"Protein translocase subunit SecE"	3	"UP000004793"	"MKDKEQAVKNKTTSTQTVTLPKTSFKDFVRGVWVELRHKVKWPTRKELLQDSSVVVGFLVFWALYIGLWDFLFAQLLKLVLSK"	"unreviewed"	"{'taxId': '511051', 'scientificName': 'Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01)', 'fullName': 'Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01)'}"
