General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 110.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7R7ZPJ7",
        "id": "A0A7R7ZPJ7_ASPCH",
        "source_organism": {
            "taxId": "182096",
            "scientificName": "Aspergillus chevalieri",
            "fullName": "Aspergillus chevalieri"
        },
        "name": "Cytochrome b mRNA-processing protein 4",
        "description": [
            "Essential for the assembly of ubiquinol-cytochrome c reductase. It has a direct effect on the correct occurrence of the Rieske protein, core 4, core 5 and apocytochrome b"
        ],
        "length": 119,
        "sequence": "MSRGSGVTWLKMLGTAIVLCVGGPALVQAIRPTDEELFKRYNPELQKRSLEEGDRRAQEFDAYVNRLKEWSKSDKSIWFAAKEQEQQRTQQAVDTPRTKANDEARIQREEMRRELLGEK",
        "proteome": "UP000637239",
        "gene": "CBP4",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "8d6bb8156c2d3be1c88cbf74a5ef059c04440800",
        "counters": {
            "domain_architectures": 1274,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1274
        }
    }
}