"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7K7TLB9"	"{'domain_architectures': 1702, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1702}"	"[""Accessory subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Could also play a role in RNA transport""]"	"Rtraf"	""	"A0A7K7TLB9_9CHAR"	"a03094a8f674a0ab9f1b8b5c715d60242c10232b"	True	True	224	"tRNA-splicing ligase complex subunit RTRAF"	3	"UP000587655"	"DETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSDDWPKSFEKYMKDVNCPFKIQERQETVDWLLGLAVRLEYGDNADKYKDSTPDGAKNTDNTAKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAIAKATQSKEGLPVALEKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR"	"unreviewed"	"{'taxId': '425643', 'scientificName': 'Ibidorhyncha struthersii', 'fullName': 'Ibidorhyncha struthersii'}"