"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7K7NHE3"	"{'domain_architectures': 2941, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2941}"	"['Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. Regulates calcium efflux at the endoplasmic reticulum']"	"Sigmar1"	""	"A0A7K7NHE3_HALAL"	"fa26940a01da7164d0d08c08b4cab1df03e2d311"	True	True	174	"Sigma non-opioid intracellular receptor 1"	3	"UP000585422"	"AGLDHELAFSKIIVELRKKHPGHILPDEDLQWVFVNAGGWMGSMCLLHASLTEYVLLFGTAVDTGGHSGRYWADISDTVISGTFRQWKEGTTRSEIYYPGDTIVHQAGEATSVQWSAGTWMVEYGRGFIPSTLAFALADTLFSTQDFVTLFYTLRVYAKGLLLEANAFFSTLGC"	"unreviewed"	"{'taxId': '8969', 'scientificName': 'Haliaeetus albicilla', 'fullName': 'Haliaeetus albicilla (White-tailed sea-eagle)'}"