"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7J8H575"	"{'domain_architectures': 242492, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'pfam': 1, 'smart': 3, 'ssf': 1, 'ncbifam': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 242492}"	"['The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion']"	"HJG63_016290"	"[{'identifier': 'GO:0003924', 'name': 'GTPase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A7J8H575_ROUAE"	"31aa1b32c82271990f81b4779ae58d1cb9b14b00"	True	False	246	"Ras-related protein Rab-36"	3	"UP000593571"	"MLPASVETRGLSGSASPRWLSSATSTWARPASSTGAPTGHASQHQIVRPLPGRPRFCKNVFDHDYKATIGVDFEIERFEIVGIPYSLQIWDTAGQEKFKCIASAYYRGAQVIITAFDLTDMQTLEHTRQWLEEALRENEPGSCFVFLVGTKKDLLSGAACVQAEVEAMHLANEMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLRDLERRSSARLQVGNGDLIRMEGGPPQTPESKRLSSLGCC"	"unreviewed"	"{'taxId': '9407', 'scientificName': 'Rousettus aegyptiacus', 'fullName': 'Rousettus aegyptiacus (Egyptian fruit bat)'}"