"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7J8G2A1"	"{'domain_architectures': 3433, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3433}"	"['Central receptor component of the translocase of the outer membrane of mitochondria (TOM) complex essential for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOMM20, functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore. The TOM complex associates with the ion channel VDAC2 and PINK1 kinase at depolarized mitochondria, this interaction stabilizes PINK1 at the outer mitochondrial membrane and triggers downstream mitophagy by the recruitment of the E3 ubiquitin ligase PRKN. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases']"	"HJG59_018601"	"[{'identifier': 'GO:0006886', 'name': 'intracellular protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005741', 'name': 'mitochondrial outer membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A7J8G2A1_MOLMO"	"46a5c5bec87746f4a1e7058007eebf6d99214b86"	True	False	142	"Mitochondrial import receptor subunit TOM22 homolog"	3	"UP000550707"	"MAAAAVAAGPGAPLPPDELLPKGDAEKTEEELEEDDDDELDETLSERLWGLTEMFPERIRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI"	"unreviewed"	"{'taxId': '27622', 'scientificName': 'Molossus molossus', 'fullName': ""Molossus molossus (Pallas' mastiff bat)""}"
