"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7J7ETF8"	"{'domain_architectures': 15083, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cdd': 1, 'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'ncbifam': 1, 'prints': 1, 'prosite': 2, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 15083}"	"['Catalytic component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Specifically cleaves N-terminal signal peptides that contain a hydrophobic alpha-helix (h-region) shorter than 18-20 amino acids']"	"HPG69_003697"	"[{'identifier': 'GO:0004252', 'name': 'serine-type endopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051604', 'name': 'protein maturation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008233', 'name': 'peptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A7J7ETF8_DICBM"	"21a303415f586161a7ae3f861798b3e824195375"	True	False	161	"Signal peptidase complex catalytic subunit SEC11"	3	"UP000551758"	"MVRAGAVGTHLPASGLDIFGDLRKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGMLFWL"	"unreviewed"	"{'taxId': '77932', 'scientificName': 'Diceros bicornis minor', 'fullName': 'Diceros bicornis minor (South-central black rhinoceros)'}"
