"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7J6BPI7"	"{'domain_architectures': 2355, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'prints': 2, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2355}"	"['Dynorphin peptides differentially regulate the kappa opioid receptor. Dynorphin A(1-13) has a typical opioid activity, it is 700 times more potent than Leu-enkephalin', 'Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress', 'Leumorphin has a typical opioid activity and may have anti-apoptotic effect']"	"G5714_022292"	"[{'identifier': 'GO:0007218', 'name': 'neuropeptide signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A7J6BPI7_9TELE"	"6fa08cbd40ae6cd5bb2038f6d2313e3785d0712e"	True	False	False	252	"Proenkephalin-B"	3	"UP000579812"	"MMEWYVLVLMLSLPTLSQADCSAQCLRCAQQISDLDSAVNRLTCTLECEGAVPSTSTLDRCEKALQELSDEFADLNPDADGERSALNAEDLQEKASNLVKRYGGFIKRIDKNKNKFYASPWKENAILKGLFAKKYGDSLSKLGERDVPSITEDDEGEDVTAENETGVYDNDVPLNEVKRYGGFLRKFGPKRSNFVDNTSPQVLQKRYGGFMRRIRPKLRWDNQKRYGGFLRRHFKISVRSDEEPSSYEDYAL"	"unreviewed"	"{'taxId': '369639', 'scientificName': 'Onychostoma macrolepis', 'fullName': 'Onychostoma macrolepis'}"