"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7F8PYY9"	"{'domain_architectures': 1246, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'profile': 1, 'panther': 1, 'prints': 1, 'prosite': 2, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1246}"	"['Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways']"	"CGA"	"[{'identifier': 'GO:0005179', 'name': 'hormone activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A7F8PYY9_LEPWE"	"c41de36a481f7d27550f55756c70e925da8ec8a1"	True	False	False	120	"Glycoprotein hormones alpha chain"	3	"UP000245341"	"MDYYRKYAAVILATLSVFLHILHSFPDGEFAMQGCPECKLKENKYFSKLGAPIYQCVGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS"	"unreviewed"	"{'taxId': '9713', 'scientificName': 'Leptonychotes weddellii', 'fullName': 'Leptonychotes weddellii (Weddell seal)'}"