"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P8VTC2"	"{'domain_architectures': 2983, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2983}"	"['Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. May be involved in Mg(2+) transport']"	"mmgt1"	""	"A0A6P8VTC2_GYMAC"	"9e6ba804fc9271b98ec61997447775d85d4f123c"	True	False	False	129	"Membrane magnesium transporter"	3	"UP000515161"	"MASSFWKGVVGVGLFALAHAAFSAAQHRSYMRLTEKEDETLPIDIVLQTLLSFVMTCYGIVNIAGEFKDMDASSELKNKTFDTLRNHPSFYLFNHRGRVLFRTLEEEPSSARNQALPNPLRLRKLENLH"	"unreviewed"	"{'taxId': '8218', 'scientificName': 'Gymnodraco acuticeps', 'fullName': 'Gymnodraco acuticeps (Antarctic dragonfish)'}"