"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P8SCJ6"	"{'domain_architectures': 122920, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'profile': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 122920}"	"[""Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes 'Lys-11'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit. Also acts by elongating ubiquitin chains initiated by the E2 enzyme UBE2D1/UBCH5 in vitro; it is however unclear whether UBE2D1/UBCH5 acts as an E2 enzyme for the APC/C in vivo. Also involved in ubiquitination and subsequent degradation of VHL, resulting in an accumulation of HIF1A. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, except 'Lys-48'-linked polyubiquitination""]"	"UBE2S"	""	"A0A6P8SCJ6_GEOSA"	"96b2a7d582dea26386e8f982d2fd40014d2b06f9"	True	False	False	210	"E2 ubiquitin-conjugating enzyme"	3	"UP000515159"	"MNSNVENLPPHIIRLVYKEVSTLTSDPPEGIKIFPNEEDITDLQVTIEGPEGTPYAGGIFRMKLILGKDFPAMPPKGYFLTKIFHPNVGSNGEICVNVLKKDWKAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHAQVCSLRAKDQAATADPCSSSATGDGPMAKKHAGDRDKKLAAKKKTDKKRALRRL"	"unreviewed"	"{'taxId': '260995', 'scientificName': 'Geotrypetes seraphini', 'fullName': 'Geotrypetes seraphini (Gaboon caecilian)'}"