"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P7I985"	"{'domain_architectures': 7100, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ncbifam': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 7100}"	"['The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle', 'This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane']"	"LOC114432958"	"[{'identifier': 'GO:0006813', 'name': 'potassium ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006814', 'name': 'sodium ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005890', 'name': 'sodium:potassium-exchanging ATPase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A6P7I985_9TELE"	"edc17df419148265b8eea0f3941c45befc5b4f1c"	True	False	291	"Sodium/potassium-transporting ATPase subunit beta"	3	"UP000515145"	"MATLKEKRTCGQRCEDFGHFVWNSDNGTLMGRTPEKWVYISLYYVAFYVVMTGLFSLAIWVLMYTLCPYAPDYQDRLKSPGVMVWPDTYGEEDVEITYNTSDKASWMKMANILHSFLKPYNDTMQTECNRYNCTQGKYFIQNTFSAPHHTKWACPFKQSMLGQCSGLEDPTFGYNSTMPCVIIKMNRIINFLPSNHTNHPPYVNCTILEGQNNVDKIEYFPERGIMDLSYFPYYGKLAQPTYANPLVAVRFNLVREKQAKIQCRAVSDKISYENIHDPYEGKVVFYLKAVK"	"unreviewed"	"{'taxId': '210632', 'scientificName': 'Parambassis ranga', 'fullName': 'Parambassis ranga (Indian glassy fish)'}"
