"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P5PCE7"	"{'domain_architectures': 131174, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'smart': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prints': 2, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 131174}"	"['Plays a role as a transcriptional activator or repressor. Inhibits several cytokine signaling pathways, such as TGFB1, activin-A/INHBA and BMP4 by interfering with the transcriptional stimulatory activity of transcription factors, such as MSX2, FAST2, SMAD2 and SMAD3 during hematopoietic cell differentiation. Plays a role in terminal differentiation of interneurons, such as amacrine and bipolar cells in the developing retina. Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis and may be involved in the early development of diencephalic subdivisions']"	"Dlx1"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000981', 'name': 'DNA-binding transcription factor activity, RNA polymerase II-specific', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A6P5PCE7_MUSCR"	"1cca9db9652b5e6e0313f2eed7be72cec278d12f"	True	False	255	"Homeobox protein DLX-1"	3	"UP000515126"	"MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM"	"unreviewed"	"{'taxId': '10089', 'scientificName': 'Mus caroli', 'fullName': 'Mus caroli (Ryukyu mouse)'}"
