"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6J3FST8"	"{'domain_architectures': 1036, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 2, 'ssf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1036}"	"['Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy. Stabilizes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3. Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1. May be involved in autophagosome biogenesis. May play a role in neural progenitor cell survival during differentiation', 'May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro)']"	"NRBF2"	"[{'identifier': 'GO:0006914', 'name': 'autophagy', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A6J3FST8_SAPAP"	"7554e71c3ca00fab3156fcb8d1f73b85de366e72"	True	False	False	287	"Nuclear receptor-binding factor 2"	4	"UP000504640"	"MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDVAAHLQASHKPSAEDAEGQSPLSQKYPPSTEKRLPEIQGIFDRDPDTLLYLLQQKSEPVEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEMARLLKGPIEKELDVDADFVETSELWSLPPHSETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN"	"unreviewed"	"{'taxId': '9515', 'scientificName': 'Sapajus apella', 'fullName': 'Sapajus apella (Brown-capped capuchin)'}"
