"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6J2VUI2"	"{'domain_architectures': 37286, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'pfam': 2, 'cdd': 1, 'panther': 1, 'pirsf': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 37286}"	"['Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2)']"	"prdx2"	"[{'identifier': 'GO:0016209', 'name': 'antioxidant activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051920', 'name': 'peroxiredoxin activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A6J2VUI2_CHACN"	"9db26b9b236ea914ef8a2d52a7760b3ae17fb31b"	True	False	False	197	"Peroxiredoxin-2"	3	"UP000504632"	"MSAGNAKIGQPAPQFKATAVVDGQFKDIQLSDYRGKYVVFFFYPLDFTFVCPTEIIAFSERADEFRKIGCEVLAASTDSHFSHLAWINTPRKQGGLGSMNIPLVADLTQSIARDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSVDETVRLVQAFQFTDKHGEVCPAGWKPGSDTIVPDVQKSKEFFSKQ"	"unreviewed"	"{'taxId': '29144', 'scientificName': 'Chanos chanos', 'fullName': 'Chanos chanos (Milkfish)'}"
