"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6J2DPS6"	"{'domain_architectures': 3238, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3238}"	"['Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains']"	"PKIB"	"[{'identifier': 'GO:0004862', 'name': 'cAMP-dependent protein kinase inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006469', 'name': 'negative regulation of protein kinase activity', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A6J2DPS6_ZALCA"	"32eeb43e0e7af0c3d1ab36803098211898add135"	True	False	109	"cAMP-dependent protein kinase inhibitor beta isoform X2"	3	"UP000515165"	"MDVHLDTPEGQESASNSGKGSNGTGNQQDVVMRTDPSEMTDVESVVNNFASSARTGRRNAVPDIQGSAGTGGPSELPLKLEALSIKEDVKKKNEETTQRQLEKPKKEEK"	"unreviewed"	"{'taxId': '9704', 'scientificName': 'Zalophus californianus', 'fullName': 'Zalophus californianus (California sealion)'}"
