"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6J2DMK5"	"{'domain_architectures': 0, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'panther': 1, 'prosite': 1, 'prints': 2, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1}"	"[""HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions""]"	"HMGA1"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000785', 'name': 'chromatin', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A6J2DMK5_ZALCA"	""	True	False	False	96	"High mobility group protein HMG-I/HMG-Y"	3	"UP000515165"	"MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ"	"unreviewed"	"{'taxId': '9704', 'scientificName': 'Zalophus californianus', 'fullName': 'Zalophus californianus (California sealion)'}"