"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6I9MED9"	"{'domain_architectures': 12202, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'smart': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'prints': 2, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 12202}"	"['Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo']"	"Lta"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005164', 'name': 'tumor necrosis factor receptor binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006955', 'name': 'immune response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A6I9MED9_PERMB"	"452ab3949debfc11bfeb581670598a02215fe991"	True	False	202	"Lymphotoxin-alpha"	3	"UP000694547"	"MTPLGRLYLLRVLGAPPVFLLGLLLALPLGPQGLSGVRSSAARIAHQPPQKHSTRGFLKPAAHLVGHPSKQNSLLWRANTDRAFLRHGFSLNNNSLLVPASGLYFVYSQVVFSGESCSPKATPAPIYLAHEVQLLSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGVSHLHFSPSSVFFGAFAL"	"unreviewed"	"{'taxId': '230844', 'scientificName': 'Peromyscus maniculatus bairdii', 'fullName': 'Peromyscus maniculatus bairdii (Prairie deer mouse)'}"