"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A674F061"	"{'domain_architectures': 4087, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4087}"	"['Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones']"	"IAPP"	"[{'identifier': 'GO:0005179', 'name': 'hormone activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A674F061_SALTR"	"5d547907d6b832628699bd68149ea78b42a3fa12"	True	False	False	129	"Calcitonin peptide-like domain-containing protein"	3	"UP000472277"	"MYHLKLPVFLLVPLVLLRCVATAPSNRYFTSSSEQESALPDREGWLVPGIVSNPFLGLISARLQRGLTSVNSHHIEKRKCNTATCVTQRLADFLTRSSNTIGTVYAPTNVGSSTYGKRDLLQPPSYLPL"	"unreviewed"	"{'taxId': '8032', 'scientificName': 'Salmo trutta', 'fullName': 'Salmo trutta (Brown trout)'}"