"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A671TCC5"	"{'domain_architectures': 3815, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3815}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"LOC107656436"	"[{'identifier': 'GO:0022904', 'name': 'respiratory electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A671TCC5_9TELE"	"17d94b08a68eeab22c2ace8618eb11677ba5a8c9"	True	False	98	"NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5"	3	"UP000472260"	"MAAVRLRILYTKILGSLQTMPQDAAYRKYTEQLINQRFNHVKAELDIENLEKKINCGQIEEVIAQAETELALSRKMTEWKPWEPLVEEAPANQWKWPI"	"unreviewed"	"{'taxId': '1608454', 'scientificName': 'Sinocyclocheilus anshuiensis', 'fullName': 'Sinocyclocheilus anshuiensis'}"
