"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A4X2LMB3"	"{'domain_architectures': 14140, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14140}"	"['Component of a transport protein particle (TRAPP) complex that may function in specific stages of inter-organelle traffic. Specifically involved in the early development of neural circuitry, likely by controlling the frequency and amplitude of intracellular calcium transients implicated in the regulation of neuron differentiation and survival']"	"TRAPPC6B"	"[{'identifier': 'GO:0043087', 'name': 'regulation of GTPase activity', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0048193', 'name': 'Golgi vesicle transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A4X2LMB3_VOMUR"	"fd3749aa4f0585b0db0c458d1e595e8772804a96"	True	False	False	158	"Trafficking protein particle complex subunit 6B"	3	"UP000314987"	"MADEALFLLLHNEMVTGVYKSADQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLDHAPKYLAFTCGLIRGGLSNLGIKSIVTAEVSAMPACKFQVMIQKM"	"unreviewed"	"{'taxId': '29139', 'scientificName': 'Vombatus ursinus', 'fullName': 'Vombatus ursinus (Common wombat)'}"