"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A4W2DM70"	"{'domain_architectures': 36652, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'cdd': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'prints': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 36652}"	"['Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins']"	"GRPEL1"	"[{'identifier': 'GO:0000774', 'name': 'adenyl-nucleotide exchange factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042803', 'name': 'protein homodimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051087', 'name': 'protein-folding chaperone binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006457', 'name': 'protein folding', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A4W2DM70_BOBOX"	"bcfacd3ac840c2030716357b736a826603778042"	True	False	False	217	"GrpE protein homolog"	3	"UP000314981"	"MAARCVRLARGSLPAFALSLRSSPRLLCTAAKQKNNGQNLEEDAGQNEQKTDLPSTEKTLMEEKVKLEEQLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCKDLLEVADILEKATQCVPQEEIRDDNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLNPLGAKFDPYEHEALFHTPVEGKEPGTVALVNKVGYKLHGRTLRPALVGVVKGA"	"unreviewed"	"{'taxId': '30522', 'scientificName': 'Bos indicus x Bos taurus', 'fullName': 'Bos indicus x Bos taurus (Hybrid cattle)'}"