"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A452IB08"	"{'domain_architectures': 107552, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'profile': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 107552}"	"['Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation']"	""	""	"A0A452IB08_9SAUR"	"96b2a7d582dea26386e8f982d2fd40014d2b06f9"	True	False	183	"NEDD8-conjugating enzyme UBC12"	3	"UP000291020"	"MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCEIDFSDQDDLLNFKLVICPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK"	"unreviewed"	"{'taxId': '38772', 'scientificName': 'Gopherus agassizii', 'fullName': ""Gopherus agassizii (Agassiz's desert tortoise)""}"