"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3Q3FHA4"	"{'domain_architectures': 340616, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'smart': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'prints': 2, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 340616}"	"['G protein-coupled receptor for catecholamines that couples to both G(s) and G(i) proteins, activating bifurcated signaling pathways. ADRB2 binds epinephrine (Epi) with an approximately 30-fold greater affinity than norepinephrine (NE). In the heart, Epi- and NE-activated ADRB2 induces rapid and slow cardiomyocyte contraction rate, respectively. Both NE and Epi promote coupling to G(s)/PKA pathway to regulate myocyte contraction rate. Epi also promotes ADRB2 coupling to G(i) proteins to exert cardioprotective effects especially in the conditions of hypoxia and oxidative stress through the G(i)/PI3K/Akt signaling pathway. ADRB2-G(s) signaling delivers proapoptotic signals in cardiomyocytes although G(i)-mediated survival effect appears to predominate. ADRB2 also transduces signals independently of PKA to regulate cellular pH by modulating Na(+)/H(+) exchanger SLC9A3 function']"	""	"[{'identifier': 'GO:0004930', 'name': 'G protein-coupled receptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007186', 'name': 'G protein-coupled receptor signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0004935', 'name': 'adrenergic receptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A3Q3FHA4_KRYMA"	"587fa3dbe4504dc051049f3cca904dd9ab631b87"	True	False	413	"Beta-2 adrenergic receptor"	3	"UP000264800"	"MGTTTTPVNLGMSNSSNSSSLNKTEEGPSDTVKIMLGMIVFLLVLVIVFGNILVITAISRFQRLQTVTNCFITSLACADLVMGLIVIPFGASNNIFNFWHFGEFWCMFWTATDVLCVTASIETLCVIAIDRYLAITSPFRYQSMLTKCKARLVILMIWVIASMISYLPIHMEWWVRNDTAAMACYENPNCCEFDVNIFYGITSSIISFYIPLVIMIFVYSRVFQEARRQLKKIEQSVGRFQKSSDDSKSLENNNGRGLKKAKFCLREHKALKTLGIIMGVFTLCWLPFFLLNVVMSIQGKDYKAAFKILNWIGYSNSAFNPIIYCRSPDFRYAFTEILCLNRNHLSNPGPMNEYFYSRHSWQSEPQGRSKGSLDDMDTSERCPEKGAGVCCLTDKTVDPNGNNKSLSTVTTSL"	"unreviewed"	"{'taxId': '37003', 'scientificName': 'Kryptolebias marmoratus', 'fullName': 'Kryptolebias marmoratus (Mangrove killifish)'}"