"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3P9IE17"	"{'domain_architectures': 795, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 795}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	""	"[{'identifier': 'GO:0005739', 'name': 'mitochondrion', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0045271', 'name': 'respiratory chain complex I', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A3P9IE17_ORYLA"	"f78686d7a584e7a44c1a867ff667615ef03abc50"	True	False	False	69	"NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial"	3	""	"MTLSLLLSRVGFVSRVGSRSAFTSSKTDTRNPNWVRVGLAFGSSAFLWALLFKQHSTDVHEYKVRNGLQ"	"unreviewed"	"{'taxId': '8090', 'scientificName': 'Oryzias latipes', 'fullName': 'Oryzias latipes (Japanese rice fish)'}"