"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3P9BTC8"	"{'domain_architectures': 2252, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pirsf': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2252}"	"['Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones']"	""	"[{'identifier': 'GO:0004114', 'name': ""3',5'-cyclic-nucleotide phosphodiesterase activity"", 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0030553', 'name': 'cGMP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007601', 'name': 'visual perception', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A3P9BTC8_9CICH"	"d843fd2591409e9891624b91b9308b7a0330a126"	True	False	False	87	"Rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma"	3	"UP000265160"	"MNLEPPKAEIKSATRVSGGPATPRKGPPKFKQRQTRQFKSKPPKKGIQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII"	"unreviewed"	"{'taxId': '106582', 'scientificName': 'Maylandia zebra', 'fullName': 'Maylandia zebra (zebra mbuna)'}"